PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe5G236600.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 330aa    MW: 37142.9 Da    PI: 9.0921
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe5G236600.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.53.2e-182267147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                       rg W + Ede+l ++v+q+G+ +W++Ia +++ gR++k+c++rw++ 
  Aqcoe5G236600.2.p 22 RGHWRPAEDEKLRQLVEQYGPQNWNSIADKLQ-GRSGKSCRLRWFNQ 67
                       899*****************************.***********996 PP

2Myb_DNA-binding59.28.9e-1974117146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        r ++++eE+e+l+ a++ +G++ W++Iar ++ gRt++++k++w+ 
  Aqcoe5G236600.2.p  74 RRPFSEEEEERLLAAHRVHGNK-WALIARLFP-GRTDNSVKNHWHV 117
                        679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.5061768IPR017930Myb domain
SMARTSM007176.1E-152170IPR001005SANT/Myb domain
SuperFamilySSF466891.76E-2921115IPR009057Homeodomain-like
PfamPF002492.4E-172267IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-272375IPR009057Homeodomain-like
CDDcd001671.46E-142566No hitNo description
PROSITE profilePS5129427.48569123IPR017930Myb domain
SMARTSM007176.5E-1673121IPR001005SANT/Myb domain
PfamPF002499.2E-1674116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2176121IPR009057Homeodomain-like
CDDcd001675.19E-885116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MMEDSAGGGS TSNDEAKNCC PRGHWRPAED EKLRQLVEQY GPQNWNSIAD KLQGRSGKSC  60
RLRWFNQLDP RINRRPFSEE EEERLLAAHR VHGNKWALIA RLFPGRTDNS VKNHWHVIMA  120
RRQRERSKLY GKRGSHDFFH SISGTTTSNS YPRRPLESHG EYYSKETRHD SSRILEFSNN  180
YKDGAFDTSS SKSWQCSFSG ATTATNSIPF NIFGGQRDLA TTSRSNYCIM ENSFSSDQYY  240
NGSTYGGYGN LGASGINKYD KVQHHPYGCS SVVDGTTITS ELLQNGNIHT KPPSRFKLVM  300
STTTQQEQGD ASIKHKDVPF IDFLGVGIS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C8e-31221224104C-Myb DNA-Binding Domain
1mse_C8e-31221224104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010270380.11e-105PREDICTED: transcription factor MYB23
TrEMBLA0A0E4FJ101e-100A0A0E4FJ10_9R
STRINGVIT_18s0001g15260.t014e-98(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.12e-65myb domain protein 52